PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG030614.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NAC
Protein Properties Length: 381aa    MW: 43508.2 Da    PI: 5.9326
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG030614.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.22.3e-51151431128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                  +ppGfrFhPt+eel+++yL+kkv+ +k++l evi++vd++k+ePwd+++  k+ +  +++wyfFs++dkky+ g+r+nrat++g+Wkatg+dk ++  
  CCG030614.1  15 VPPGFRFHPTEEELLDYYLRKKVSYEKIDL-EVIRDVDLNKLEPWDIQErcKIGTaPQNDWYFFSHKDKKYPAGTRTNRATAAGFWKATGRDKVIYG- 110
                  69****************************.99**************962433333556*************************************9. PP

          NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                  +g+ vg++ktLvfykgrap+g+k+dW+mheyrl
  CCG030614.1 111 TGKRVGMRKTLVFYKGRAPHGQKSDWIMHEYRL 143
                  9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-589173IPR003441NAC domain
PROSITE profilePS5100557.115173IPR003441NAC domain
PfamPF023651.6E-2716143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MTENMSISVN GQSQVPPGFR FHPTEEELLD YYLRKKVSYE KIDLEVIRDV DLNKLEPWDI  60
QERCKIGTAP QNDWYFFSHK DKKYPAGTRT NRATAAGFWK ATGRDKVIYG TGKRVGMRKT  120
LVFYKGRAPH GQKSDWIMHE YRLDDNPSET TVSNVVGEAA QEDGWVVCRI FKKKNLNKTL  180
DRAMSSSPIT ADTRNQTLSS CNEGSLDQML HYMGSTCKEE NEADNSARYL WPIDTATNHV  240
HHDNRFMELP SLESPNSTSS LNFYQSMITE NEGSITNQVS YPLDSGLNNW VALDSLVASQ  300
INGQAETSRQ SACFPNDPTM TYCTPTDLHH DLQFPTLRSS FSFPSNRSYH ETQDYNSEID  360
LWNFSIRSSS DPQWHLSNTS V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-4991759170Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5999410.0AB599941.1 Populus trichocarpa PtVNS10 mRNA for transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011025381.10.0PREDICTED: NAC domain-containing protein 43
SwissprotQ84WP61e-137NAC43_ARATH; NAC domain-containing protein 43
TrEMBLF1T1150.0F1T115_POPTR; Transcription factor
STRINGPOPTR_0002s17950.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-128NAC family protein